Protein Info for Rv0173 in Mycobacterium tuberculosis H37Rv

Annotation: Possible Mce-family lipoprotein LprK (Mce-family lipoprotein Mce1E)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 20 to 309 (290 residues), 301.8 bits, see alignment E=2.3e-94 PF02470: MlaD" amino acids 51 to 124 (74 residues), 56 bits, see alignment E=4e-19 PF11887: Mce4_CUP1" amino acids 131 to 298 (168 residues), 37.1 bits, see alignment E=2.6e-13

Best Hits

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 100% identity to mtc:MT0182)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>Rv0173 Possible Mce-family lipoprotein LprK (Mce-family lipoprotein Mce1E) (Mycobacterium tuberculosis H37Rv)
MMSVLARMRVMRHRAWQGLVLLVLALLLSSCGWRGISNVAIPGGPGTGPGSYTIYVQMPD
TLAINGNSRVMVADVWVGSIRAIKLKNWVATLTLSLKKDVTLPKNATAKIGQTSLLGSQH
VELAAPPDPSPVPLKDGDTIPLKRSSAYPTTEQTLASIATLLRGGGLVNLEGIQQEINAI
VTGRADQIRAFLGKLDTFTDELNQQRDDITRAIDSTNRLLAYVGGRSEVLNRVLTDLPPL
IKHFADKQELLINASDAVGRLSQSADQYLSAARGDLHQDLQALQCPLKELRRAAPYLVGA
LKLILTQPFDVDTVPQLVRGDYMNLSLTLDLTYSAIDNAFLTGTGFSGALRALEQSFGRD
PETMIPDIRYTPNPNDAPGGPLVERGNRQC