Protein Info for Rv0169 in Mycobacterium tuberculosis H37Rv

Annotation: Mce-family protein Mce1A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 331 to 358 (28 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 17 to 305 (289 residues), 289 bits, see alignment E=1.8e-90 PF02470: MlaD" amino acids 44 to 125 (82 residues), 51.7 bits, see alignment E=8.3e-18 PF11887: Mce4_CUP1" amino acids 131 to 329 (199 residues), 254.6 bits, see alignment E=8.6e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtu:Rv0169)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>Rv0169 Mce-family protein Mce1A (Mycobacterium tuberculosis H37Rv)
MTTPGKLNKARVPPYKTAGLGLVLVFALVVALVYLQFRGEFTPKTQLTMLSARAGLVMDP
GSKVTYNGVEIGRVDTISEVTRDGESAAKFILDVDPRYIHLIPANVNADIKATTVFGGKY
VSLTTPKNPTKRRITPKDVIDVRSVTTEINTLFQTLTSIAEKVDPVKLNLTLSAAAEALT
GLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQLAALGDVYADAAPDLFDFLDSSVTTAR
TINAQQAELDSALLAAAGFGNTTADVFDRGGPYLQRGVADLVPTATLLDTYSPELFCTIR
NFYDADPLAKAASGGGNGYSLRTNSEILSGIGISLLSPLALATNGAAIGIGLVAGLIAPP
LAVAANLAGALPGIVGGAPNPYTYPENLPRVNARGGPGGAPGCWQPITRDLWPAPYLVMD
TGASLAPYNHMEVGSPYAVEYVWGRQVGDNTINP