Protein Info for Rv0168 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved integral membrane protein YrbE1B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 60 to 86 (27 residues), see Phobius details amino acids 92 to 117 (26 residues), see Phobius details amino acids 124 to 134 (11 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details PF02405: MlaE" amino acids 70 to 275 (206 residues), 182 bits, see alignment E=6.1e-58

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to mbt:JTY_0174)

Predicted SEED Role

"Conserved hypothetical integral membrane protein YrbE1B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>Rv0168 Conserved integral membrane protein YrbE1B (Mycobacterium tuberculosis H37Rv)
MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQIAHALRYYRKETLRL
IAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIGVEAFTGFFAALINVRI
AGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSISFLASTRIMAGLVVIIPL
YALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFWSFLEALIITAIVMVSHCY
YGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGVDPNFNLTV