Protein Info for Rv0167 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved integral membrane protein YrbE1A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 152 to 179 (28 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF02405: MlaE" amino acids 47 to 256 (210 residues), 192.9 bits, see alignment E=2.8e-61

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to mtu:Rv0167)

Predicted SEED Role

"Conserved hypothetical integral membrane protein YrbE A Subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>Rv0167 Conserved integral membrane protein YrbE1A (Mycobacterium tuberculosis H37Rv)
VTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWREFILQCWFIMRVGFLP
TIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPLTTVLVVAGAGSTAICA
DLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGLVITVGLVGGFLFGVYLQ
NVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRGLTVRGGSKGLGTAVNETV
VLCVIALFAVNVILTTIGVRFGTGR