Protein Info for Rv0152c in Mycobacterium tuberculosis H37Rv

Annotation: PE family protein PE2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 429 to 449 (21 residues), see Phobius details amino acids 462 to 477 (16 residues), see Phobius details PF08237: PE-PPE" amino acids 111 to 335 (225 residues), 242.6 bits, see alignment E=1.9e-76

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10153)

Predicted SEED Role

"PE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>Rv0152c PE family protein PE2 (Mycobacterium tuberculosis H37Rv)
MRCRPPSRNRSAHTARNTRPCSLKSRRFTVRFHQTLAAAANSYADAEAAIASTRQNQLAV
PAAAPTPAAAAMIPPFPANLTTLFFGPTGIPLPPPSMLTPPIRCRSVRRALQAVFTPEEL
YPLTGVRSLVLNTSVEEGLTILHDAIMVELATTGNAVTVFGWSQSAIIASLEMQRFTAMG
GAAPSASDLNFVLVGNEMNPNGGMLARFPDLTLPTLDLTFYGATPSDTIYPTAIYTLEYD
GFADFSRYPLNFISDLNAVAGITFVHTKYLDLTPAQVEGATKLPTSPGYTGVTDYYIIRT
ENRPLLQPLRAVPVIGDPLADLIQPNLKVIVNLGYGDPNYGYSTSYADVRTPFGLWPNVP
PQVIADALAAGTQEGILDFTADLQALSAQPLTLPQIQLPQPADLVAAVAAAPTPAEVVNT
LARIISTNYAVLLPTVDIALALVTTLPLYTTQLFVRQLAAGNLINAIGYPLAATVGLGTI
DSGRRGIAHPPRGGLGHRSKHRGPRHLTDSRRHRRPPTTVYRPRQ