Protein Info for Rv0143c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 199 to 225 (27 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 315 to 340 (26 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 411 to 437 (27 residues), see Phobius details amino acids 443 to 463 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 113 to 460 (348 residues), 287 bits, see alignment E=1.1e-89

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to mbo:Mb0148c)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>Rv0143c Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MAPGDWSVFAWHAANLPTMPEAEDIGNEAAGGRFGVSIRSAGYLRKWFLLGITIGVIAGL
GAVVFYLALKYTSEFLLGYLADYQIPTPVGEGGHRGSTGFARPWAIPLVTTGGAVLSALI
VAKLAPEATGHGTDEAIESVHGDPRAIRGRAVLVKMVASALTIGSGGSGGREGPTAQISA
GFCSLLTRRLNLSNEDGRTAVALGIGAGIGAIFAAPLGGAALGASIPYRDDFDYRNLLPG
FIASGTAYAVLGAFLGFDPLFGYIDAEYRFEKAWPLLWFVVIGLIAAAVGYLYARVFHAS
VAITRRLPGGPVLKPAIGGLLVGLLGLPIPQILSSGYGWAQLAADRGTLLSIPLWIVIVL
PIAKILATSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLGELTELPGVPHEPGIFVVVAMM
ACFGSVSRAPLAVMIMVAEMTGSFSVVPGAIIAVGIAALLLSRTNVTIYETQRLNRQTAE
AERGGSDRPTTA