Protein Info for Rv0137c in Mycobacterium tuberculosis H37Rv

Annotation: Probable peptide methionine sulfoxide reductase MsrA (protein-methionine-S-oxide reductase) (peptide met(O) reductase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 6 to 153 (148 residues), 167.3 bits, see alignment E=1.6e-53 PF01625: PMSR" amino acids 6 to 154 (149 residues), 191.4 bits, see alignment E=5.6e-61

Best Hits

Swiss-Prot: 100% identical to MSRA_MYCTU: Peptide methionine sulfoxide reductase MsrA (msrA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 100% identity to mtc:MT0145)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>Rv0137c Probable peptide methionine sulfoxide reductase MsrA (protein-methionine-S-oxide reductase) (peptide met(O) reductase) (Mycobacterium tuberculosis H37Rv)
MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGTHAEAVEIIFDP
TVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLW
PGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRLPRRTAESALRASLSPEL
GT