Protein Info for Rv0134 in Mycobacterium tuberculosis H37Rv

Annotation: Possible epoxide hydrolase EphF (epoxide hydratase) (arene-oxide hydratase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF00561: Abhydrolase_1" amino acids 34 to 281 (248 residues), 117 bits, see alignment E=1.7e-37 PF12146: Hydrolase_4" amino acids 35 to 141 (107 residues), 36 bits, see alignment E=7.3e-13 PF12697: Abhydrolase_6" amino acids 37 to 286 (250 residues), 70 bits, see alignment E=7.2e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10135)

Predicted SEED Role

"epoxide hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>Rv0134 Possible epoxide hydrolase EphF (epoxide hydratase) (arene-oxide hydratase) (Mycobacterium tuberculosis H37Rv)
MIALPALEGVEHRHVDVAEGVRIHVADAGPADGPAVMLVHGFPQNWWEWRDLIGPLAADG
NRVLCPDLRGAGWSSAPRSRYTKTEMADDLAAVLDGLGVAKVKLVAHDWGGPVAFIMMLR
HPEKVTGFFGVNTVAPWVKRDLGMLRNMWRFWYQIPMSLPVIGPRVISDPKGRYFRLLTG
WVGGGFRVPDDDVRLYLDCMREPGHAEAGSRWYRTFQTREMLRWLRGEYNDARVDVPVRW
LHGTGDPVITPDLLDGYAERASDFEVELVDGVGHWIVEQRPELVLDRVRAFLAAGTEQRD