Protein Info for Rv0132c in Mycobacterium tuberculosis H37Rv

Annotation: Putative F420-dependent glucose-6-phosphate dehydrogenase Fgd2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR04465: TAT-translocated F420-dependent dehydrogenase, FGD2 family" amino acids 2 to 360 (359 residues), 732.3 bits, see alignment E=9.1e-225 TIGR03557: F420-dependent oxidoreductase, G6PDH family" amino acids 44 to 360 (317 residues), 241 bits, see alignment E=1.8e-75 PF00296: Bac_luciferase" amino acids 49 to 281 (233 residues), 182.9 bits, see alignment E=5.1e-58

Best Hits

Swiss-Prot: 100% identical to FHMAD_MYCTU: F420-dependent hydroxymycolic acid dehydrogenase (fgd2) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT0140)

Predicted SEED Role

"Similar to F420-dependent glucose-6-phosphate dehydrogenase, BCG_0166c family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>Rv0132c Putative F420-dependent glucose-6-phosphate dehydrogenase Fgd2 (Mycobacterium tuberculosis H37Rv)
MTGISRRTFGLAAGFGAIGAGGLGGGCSTRSGPTPTPEPASRGVGVVLSHEQFRTDRLVA
HAQAAEQAGFRYVWASDHLQPWQDNEGHSMFPWLTLALVGNSTSSILFGTGVTCPIYRYH
PATVAQAFASLAILNPGRVFLGLGTGERLNEQAATDTFGNYRERHDRLIEAIVLIRQLWS
GERISFTGHYFRTDELKLYDTPAMPPPIFVAASGPQSATLAGRYGDGWIAQARDINDAKL
LAAFAAGAQAAGRDPTTLGKRAELFAVVGDDKAAARAADLWRFTAGAVDQPNPVEIQRAA
ESNPIEKVLANWAVGTDPGVHIGAVQAVLDAGAVPFLHFPQDDPITAIDFYRTNVLPELR