Protein Info for Rv0130 in Mycobacterium tuberculosis H37Rv

Annotation: Probable 3-hydroxyl-thioester dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF01575: MaoC_dehydratas" amino acids 11 to 131 (121 residues), 118.9 bits, see alignment E=1.1e-38 PF13452: MaoC_dehydrat_N" amino acids 14 to 129 (116 residues), 27.1 bits, see alignment E=4.1e-10

Best Hits

Swiss-Prot: 100% identical to ECH1_MYCTU: Probable enoyl-CoA hydratase 1 (Rv0130) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_0137)

MetaCyc: 47% identical to 4-chloro-3-hydroxybutyryl-CoA dehydratase (Salinispora tropica)
4.2.1.-

Predicted SEED Role

"Probable enoyl-CoA hydratase 1 (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>Rv0130 Probable 3-hydroxyl-thioester dehydratase (Mycobacterium tuberculosis H37Rv)
MRTFESVADLAAAAGEKVGQSDWVTITQEEVNLFADATGDHQWIHVDPERAAAGPFGTTI
AHGFMTLALLPRLQHQMYTVKGVKLAINYGLNKVRFPAPVPVGSRVRATSSLVGVEDLGN
GTVQATVSTTVEVEGSAKPACVAESIVRYVA