Protein Info for Rv0127 in Mycobacterium tuberculosis H37Rv

Annotation: Maltokinase Mak

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF18085: Mak_N_cap" amino acids 16 to 96 (81 residues), 51.1 bits, see alignment E=1.1e-17

Best Hits

Swiss-Prot: 100% identical to MAK_MYCTA: Maltokinase (mak) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_0161)

MetaCyc: 100% identical to maltokinase (Mycobacterium tuberculosis H37Rv)
RXN-12960 [EC: 2.7.1.175]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.175

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>Rv0127 Maltokinase Mak (Mycobacterium tuberculosis H37Rv)
MTRSDTLATKLPWSDWLSRQRWYAGRNRELATVKPGVVVALRHNLDLVLVDVTYTDGATE
RYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGPQFLLSLIVSSAVCGTSTGEV
TFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVSSGINPDIELNRVLTRAG
NPHVARLLGAYQFGRPNRSPTDALAYALGMVTEYEANAAEGWAMATASVRDLFAEGDLYA
HEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRMLARLSSTVAVVPELREYAP
TIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDFEGEPGQPLDERRAPDSPLRD
VAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAAFCDGYAVASGIDPRDSALLLG
AYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS