Protein Info for Rv0120c in Mycobacterium tuberculosis H37Rv

Annotation: Probable elongation factor G FusA2 (EF-G)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 714 PF00009: GTP_EFTU" amino acids 23 to 286 (264 residues), 133.2 bits, see alignment E=3.1e-42 TIGR00231: small GTP-binding protein domain" amino acids 24 to 154 (131 residues), 54 bits, see alignment E=8.6e-19 PF01926: MMR_HSR1" amino acids 25 to 149 (125 residues), 28.7 bits, see alignment E=4.4e-10 PF22042: EF-G_D2" amino acids 317 to 413 (97 residues), 35.8 bits, see alignment E=2.5e-12 PF03144: GTP_EFTU_D2" amino acids 329 to 411 (83 residues), 39.4 bits, see alignment E=2.3e-13 PF14492: EFG_III" amino acids 425 to 497 (73 residues), 81.4 bits, see alignment E=1.4e-26 PF03764: EFG_IV" amino acids 501 to 617 (117 residues), 139.5 bits, see alignment E=1.7e-44 PF00679: EFG_C" amino acids 622 to 707 (86 residues), 81.8 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 100% identical to EFGL_MYCTU: Elongation factor G-like protein (Rv0120c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to mra:MRA_0127)

Predicted SEED Role

"Translation elongation factor G-related protein" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (714 amino acids)

>Rv0120c Probable elongation factor G FusA2 (EF-G) (Mycobacterium tuberculosis H37Rv)
MADRVNASQGAAAAPTANGPGGVRNVVLVGPSGGGKTTLIEALLVAAKVLSRPGSVTEGT
TVCDFDEAEIRQQRSVGLAVASLAYDGIKVNLVDTPGYADFVGELRAGLRAADCALFVIA
ANEGVDEPTKSLWQECSQVGMPRAVVITKLDHARANYREALTAAQDAFGDKVLPLYLPSG
DGLIGLLSQALYEYADGKRTTRTPAESDTERIEEARGALIEGIIEESEDESLMERYLGGE
TIDESVLIQDLEKAVARGSFFPVIPVCSSTGVGTLELLEVATRGFPSPMEHPLPEVFTPQ
GVPHAELACDNDAPLLAEVVKTTSDPYVGRVSLVRVFSGTIRPDTTVHVSGHFSSFFGGG
TSNTHPDHDEDERIGVLSFPLGKQQRPAAAVVAGDICAIGKLSRAETGDTLSDKAEPLVL
KPWTMPEPLLPIAIAAHAKTDEDKLSVGLGRLAAEDPTLRIEQNQETHQVVLWCMGEAHA
GVVLDTLANRYGVSVDTIELRVPLRETFAGNAKGHGRHIKQSGGHGQYGVCDIEVEPLPE
GSGFEFLDKVVGGAVPRQFIPNVEKGVRAQMDKGVHAGYPVVDIRVTLLDGKAHSVDSSD
FAFQMAGALALREAAAATKVILLEPIDEISVLVPDDFVGAVLGDLSSRRGRVLGTETAGH
DRTVIKAEVPQVELTRYAIDLRSLAHGAASFTRSFARYEPMPESAAARVKAGAG