Protein Info for Rv0114 in Mycobacterium tuberculosis H37Rv

Annotation: Possible D-alpha,beta-D-heptose-1,7-biphosphate phosphatase GmhB (D-glycero-D-manno-heptose 7-phosphate kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 10 to 153 (144 residues), 176.4 bits, see alignment E=3.3e-56 TIGR01662: HAD hydrolase, family IIIA" amino acids 10 to 156 (147 residues), 121.4 bits, see alignment E=3.1e-39

Best Hits

Swiss-Prot: 100% identical to GMHBA_MYCTU: D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 100% identity to mbo:Mb0118)

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-, 5.3.1.-

Use Curated BLAST to search for 3.1.3.- or 5.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>Rv0114 Possible D-alpha,beta-D-heptose-1,7-biphosphate phosphatase GmhB (D-glycero-D-manno-heptose 7-phosphate kinase) (Mycobacterium tuberculosis H37Rv)
MVAERAGHQWCLFLDRDGVINRQVVGDYVRNWRQFEWLPGAARALKKLRAWAPYIVVVTN
QQGVGAGLMSAVDVMVIHRHLQMQLASDGVLIDGFQVCPHHRSQRCGCRKPRPGLVLDWL
GRHPDSEPLLSIVVGDSLSDLELAHNVAAAAGACASVQIGGASSGGVADASFDSLWEFAV
AVGHARGERG