Protein Info for Rv0113 in Mycobacterium tuberculosis H37Rv

Annotation: Probable sedoheptulose-7-phosphate isomerase GmhA (phosphoheptose isomerase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 34 to 148 (115 residues), 87.9 bits, E=6.7e-29
• PF01380: SIS
  • amino acids 111 to 166 (56 residues), 35.4 bits, E=8.9e-13

Best Hits

Swiss-Prot: 100% identical to GMHA_MYCTU: Phosphoheptose isomerase (gmhA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 100% identity to mtf:TBFG_10114)

MetaCyc: 45% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)
• ADP-L-glycero-β-D-manno-heptose biosynthesis (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Galactose metabolism
• Inositol phosphate metabolism
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Protein Sequence (196 amino acids)

>Rv0113 Probable sedoheptulose-7-phosphate isomerase GmhA (phosphoheptose isomerase) (Mycobacterium tuberculosis H37Rv)
VCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAGARVFMCGNGGSAADA
QHFAAELTGHLIFDRPPLGAEALHANSSHLTAVANDYDYDTVFARALEGSARPGDTLFAI
STSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADFLINVPSRDTGRIQESHIVFI
HAISEHVEHALFAPRQ