Protein Info for Rv0111 in Mycobacterium tuberculosis H37Rv

Annotation: Possible transmembrane acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 685 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 204 to 229 (26 residues), see Phobius details amino acids 241 to 258 (18 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details amino acids 404 to 427 (24 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 34 to 387 (354 residues), 94.9 bits, see alignment E=5.1e-31 PF19040: SGNH" amino acids 465 to 675 (211 residues), 36.9 bits, see alignment E=3.4e-13

Best Hits

KEGG orthology group: K00680, [EC: 2.3.1.-] (inferred from 100% identity to mbo:Mb0115)

Predicted SEED Role

"putative acyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (685 amino acids)

>Rv0111 Possible transmembrane acyltransferase (Mycobacterium tuberculosis H37Rv)
VPARSVPRPRWVAPVRRVGRLAVWDRPERRSGIPALDGLRAIAVALVLASHGGIPGMGGG
FIGVDAFFVLSGFLITSLLLDELGRTGRIDLSGFWIRRARRLLPALVLMVLTVSAARALF
PDQALTGLRSDAIAAFLWTANWRFVAQNTDYFTQGAPPSPLQHTWSLGVEEQYYVVWPLL
LIGATLLLAARARRRCRRATVGGVRFAAFLIASLGTMASATAAVAFTSAATRDRIYFGTD
TRAQALLIGSAAAALLVRDWPSLNRGWCLIRTRWGRRIARLLPFVGLAGLAVTTHVATGS
VGEFRHGLLIVVAGAAVIVVASVAMEQRGAVARILAWRPLVWLGTISYGVYLWHWPIFLA
LNGQRTGWSGPALFAARCAATVVLAGASWWLIEQPIRRWRPARVPLLPLAAATVASAAAV
TMLVVPVGAGPGLREIGLPPGVSAVAAVSPSPPEASQPAPGPRDPNRPFTVSVFGDSIGW
TLMHYLPPTPGFRFIDHTVIGCSLVRGTPYRYIGQTLEQRAECDGWPARWSAQVNRDQPD
VALLIVGRWETVDRVNEGRWTHIGDPTFDAYLNAELQRALSIVGSTGVRVMVTTVPYSRG
GEKPDGRLYPEDQPERVNKWNAMLHNAISQHSNVGMIDLNKKLCPDGVYTAKVDGIKVRS
DGVHLTQEGVKWLIPWLEDSVRVAS