Protein Info for Rv0110 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 191 to 207 (17 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details PF01694: Rhomboid" amino acids 74 to 205 (132 residues), 119 bits, see alignment E=9.7e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10111)

Predicted SEED Role

"FIG056164: rhomboid family serine protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>Rv0110 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MRVGPVGHQCAECVREGARAVRQPRTPFGGRQRSATPVVTYTLISLNALVFVMQVTVMGL
ERQLALWPPAVASGQTYRLVTSAFLHYGAMHLLLNMWALYVVGPPLEMWLGRLRFGALYA
VSALGGSVLVYLIAPLNTATAGASGAVFGLFGATFMVARRLHLDVRWVVALIVINLAFTF
LAPAISWQGHVGGLVTGALVAATYVYAPRERRNLIQATVTITVLVAFVVLIGWRTVDLLA
LFGGRLNLS