Protein Info for Rv0093c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 130 to 150 (21 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details PF13490: zf-HC2" amino acids 49 to 83 (35 residues), 35.9 bits, see alignment 3.1e-13

Best Hits

Swiss-Prot: 100% identical to Y093_MYCTU: Uncharacterized protein Rv0093c (Rv0093c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00094)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>Rv0093c Probable conserved membrane protein (Mycobacterium tuberculosis H37Rv)
VLAQATTAGSFNHHASTVLQGCRGVPAAMWSEPAGAIRRHCATIDGMDCEVAREALSARL
DGERAPVPSARVDEHLGECSACRAWFTQVASQAGDLRRLAESRPVVPPVGRLGIRRAPRR
QHSPMTWRRWALLCVGIAQIALGTVQGFGLDVGLTHQHPTGAGTHLLNESTSWSIALGVI
MVGAALWPSAAAGLAGVLTAFVAILTGYVIVDALSGAVSTTRILTHLPVVIGAVLAIMVW
RSASGPRPRPDAVAAEPDIVLPDNASRGRRRGHLWPTDGSAA