Protein Info for Rv0089 in Mycobacterium tuberculosis H37Rv

Annotation: Possible methyltransferase/methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 1 to 125 (125 residues), 24.3 bits, E=8.8e-09
• PF00398: RrnaAD
  • amino acids 10 to 83 (74 residues), 34.3 bits, E=8.5e-12
• PF00891: Methyltransf_2
  • amino acids 12 to 132 (121 residues), 26.2 bits, E=3e-09
• PF01209: Ubie_methyltran
  • amino acids 14 to 127 (114 residues), 35.8 bits, E=3.4e-12
• PF05175: MTS
  • amino acids 14 to 105 (92 residues), 38 bits, E=8.1e-13
• PF06325: PrmA
  • amino acids 21 to 117 (97 residues), 25.6 bits, E=4.9e-09
• PF13489: Methyltransf_23
  • amino acids 23 to 142 (120 residues), 49.2 bits, E=3e-16
• PF05401: NodS
  • amino acids 25 to 118 (94 residues), 34.3 bits, E=1.3e-11
• PF13649: Methyltransf_25
  • amino acids 26 to 116 (91 residues), 71.9 bits, E=3.6e-23
• PF13847: Methyltransf_31
  • amino acids 26 to 124 (99 residues), 48 bits, E=6.9e-16
• PF08241: Methyltransf_11
  • amino acids 27 to 119 (93 residues), 73.5 bits, E=1.1e-23
• PF08242: Methyltransf_12
  • amino acids 27 to 118 (92 residues), 58.7 bits, E=4.8e-19

Best Hits

Swiss-Prot: 100% identical to Y089_MYCTU: Uncharacterized methyltransferase Rv0089 (Rv0089) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to mtf:TBFG_10090)

Predicted SEED Role

"POSSIBLE METHYLTRANSFERASE/METHYLASE"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (197 amino acids)

>Rv0089 Possible methyltransferase/methylase (Mycobacterium tuberculosis H37Rv)
VDQPWNANIHYDALLDAMVPLGTQCVLDVGCGDGLLAARLARRIPYVTAVDIDAPVLRRA
QTRFANAPIRWLHADIMTAELPNAGFDAVVSNAALHHIEDTRTALSRLGGLVTPGGTLAV
VTFVTPSLRNGLWHLTSWVACGMANRVKGKWEHSAPIKWPPPQTLHELRSHVRALLPGAC
IRRLLYGRVLVTWRAPV