Protein Info for Rv0086 in Mycobacterium tuberculosis H37Rv

Annotation: Possible hydrogenase HycQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 315 to 338 (24 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details amino acids 442 to 469 (28 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 124 to 421 (298 residues), 153.6 bits, see alignment E=3.6e-49

Best Hits

KEGG orthology group: K12141, hydrogenase-4 component F [EC: 1.-.-.-] (inferred from 100% identity to mbo:Mb0089)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>Rv0086 Possible hydrogenase HycQ (Mycobacterium tuberculosis H37Rv)
MTGLLLAAILAPLAASIASLITGWRRTTATLTALSATTVLACAVAMGFWMGSGAQFGLGG
LLRADALTVVMLVVIGIVGTLATAASIGYIDTELAHGHIDGRSARLYGVLTPAFLCAMVL
AVCANNIGVIWVAIEATTVITAFLVGHRRTRTALEATWKYVVICSVGIAVAFLGTVLLYF
AARDSGAAAAGALNLDILAEHAAGLDPGVARLAGGLLLIGYGAKAGLFPFHTWLADAHSQ
APAPVSALMSGVLLAVAFSVLIRLRPILDAVSGPAYLRNGLLVVGLATLLVAVLMLTVTG
DVKRMLAYSSMEHMGLIAIAAAAGTTLAIAALLLHVLAHGIGKTVLFLAGGQLQAAHDST
AIADITGVMRRSRLIGVSFAVGLIVLLGLPPFAMFASELAIARSLANERLAWVLGAALLL
IAIGFTALARNSGRMLLGTPAAGAPAITVPATAAAALMVGIVVSAALGITAGPLADLLGI
AASNVGLP