Protein Info for Rv0085 in Mycobacterium tuberculosis H37Rv

Annotation: Possible hydrogenase HycP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 179 to 180 (2 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to Y088_MYCBO: Uncharacterized protein Mb0088 (BQ2027_MB0088) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K12140, hydrogenase-4 component E [EC: 1.-.-.-] (inferred from 100% identity to mbb:BCG_0118)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>Rv0085 Possible hydrogenase HycP (Mycobacterium tuberculosis H37Rv)
MSNANFSILVDFAAGGLVLASVLIVWRRDLRAIVRLLAWQGAALAAIPLLRGIRDNDRAL
IAVGIAVLALRALVLPWLLARAVGAEAAAQREATPLVNTASSLLITAGLTLTAFAITQPV
VNLEPGVTINAVPAAFAVVLIALFVMTTRLHAVSQAAGFLMLDNGIAATAFLLTAGVPLI
VELGASLDVLFAVIVIGVLTGRLRRIFGDADLDKLRELRD