Protein Info for Rv0084 in Mycobacterium tuberculosis H37Rv

Annotation: Possible formate hydrogenlyase HycD (FHL)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details PF00146: NADHdh" amino acids 13 to 305 (293 residues), 146 bits, see alignment E=8.3e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_0117)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>Rv0084 Possible formate hydrogenlyase HycD (FHL) (Mycobacterium tuberculosis H37Rv)
MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLLKQLGKQQITPAGT
TIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPSADLFAVVGLLFLGTVALTLAGIDTGT
SFGGMGASREITIAALVEPTILLAVFALSIPAGSANLGALVASTIDHPGHVVSLAGVLAF
VALVIVIVAETGRLPVDNPATHLELTMVHEAMVLEYAGPRLALVEWAAGMRLTVLLALLA
NLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVFLAKLRLFRVPELLAGSFL
LALLAVTAANFFTVGA