Protein Info for Rv0081 in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF12840: HTH_20" amino acids 17 to 64 (48 residues), 27.6 bits, see alignment E=2.3e-10 PF01022: HTH_5" amino acids 19 to 64 (46 residues), 32.2 bits, see alignment E=7.8e-12

Best Hits

Swiss-Prot: 99% identical to Y0081_MYCTO: Uncharacterized HTH-type transcriptional regulator MT0088 (MT0088) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 99% identity to mbb:BCG_0114)

Predicted SEED Role

"Formate hydrogenlyase subunit 7" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>Rv0081 Probable transcriptional regulatory protein (Mycobacterium tuberculosis H37Rv)
VESEPLYKLKAEFFKTLAHPARIRILELLVERDRSVGELLSSDVGLESSNLSQQLGVLRR
AGVVAARRDGNAMIYSIAAPDIAELLAVARKVLARVLSDRVAVLEDLRAGGSAT