Protein Info for Rv0070c in Mycobacterium tuberculosis H37Rv

Annotation: Serine hydroxymethyltransferase GlyA2 (serine methylase 2) (SHMT 2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF00464: SHMT" amino acids 9 to 390 (382 residues), 512.2 bits, see alignment E=1.1e-157 PF00155: Aminotran_1_2" amino acids 85 to 369 (285 residues), 34.4 bits, see alignment E=2.2e-12 PF01041: DegT_DnrJ_EryC1" amino acids 143 to 260 (118 residues), 23.3 bits, see alignment E=5.3e-09

Best Hits

Swiss-Prot: 100% identical to GLYA2_MYCTO: Serine hydroxymethyltransferase 2 (glyA2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 100% identity to mbt:JTY_0072)

MetaCyc: 57% identical to serine hydroxymethyltransferase subunit (Hyphomicrobium methylovorum GM2)
Glycine hydroxymethyltransferase. [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>Rv0070c Serine hydroxymethyltransferase GlyA2 (serine methylase 2) (SHMT 2) (Mycobacterium tuberculosis H37Rv)
MNTLNDSLTAFDPDIAALIDGELRRQESGLEMIASENYAPLAVMQAQGSVLTNKYAEGYP
GRRYYGGCEFVDGVEQLAIDRVKALFGAEYANVQPHSGATANAATMHALLNPGDTILGLS
LAHGGHLTHGMRINFSGKLYHATAYEVSKEDYLVDMDAVAEAARTHRPKMIIAGWSAYPR
QLDFARFRAIADEVDAVLMVDMAHFAGLVAAGVHPSPVPHAHVVTSTTHKTLGGPRGGII
LCNDPAIAKKINSAVFPGQQGGPLEHVIAAKATAFKMAAQPEFAQRQQRCLDGARILAGR
LTQPDVAERGIAVLTGGTDVHLVLVDLRDAELDGQQAEDRLAAVDITVNRNAVPFDPRPP
MITSGLRIGTPALAARGFSHNDFRAVADLIAAALTATNDDQLGPLRAQVQRLAARYPLYP
ELHRT