Protein Info for Rv0043c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein (probably GntR-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00392: GntR" amino acids 11 to 71 (61 residues), 47.7 bits, see alignment E=4.9e-17

Best Hits

Swiss-Prot: 100% identical to Y044_MYCBO: Uncharacterized HTH-type transcriptional regulator Mb0044c (BQ2027_MB0044C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv0043c)

Predicted SEED Role

"Transcriptional regulator, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>Rv0043c Probable transcriptional regulatory protein (probably GntR-family) (Mycobacterium tuberculosis H37Rv)
MPKKYGVKEKDQVVAHILNLLLTGKLRSGDRVDRNEIAHGLGVSRVPIQEALVQLEHDGI
VSTRYHRGAFIERFDVATILEHHELDGLLNGIASARAAANPTPRILGQLDAVMRSLRNSK
ESRAFAECVWEYRRTVNDEYAGPRLHATIRASQNLIPRVFWMTYQNSRDDVLPFYEEENA
AIHRREPEAARAACIGRSELMAQTMLAELFRRRVLVPPEGACPGPFGAPIPGFARSYQPS
SPVP