Protein Info for Rv0001 in Mycobacterium tuberculosis H37Rv

Annotation: Chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 43 to 501 (459 residues), 502.3 bits, see alignment E=7e-155 PF00308: Bac_DnaA" amino acids 168 to 385 (218 residues), 346.6 bits, see alignment E=1.4e-107 PF01695: IstB_IS21" amino acids 204 to 307 (104 residues), 28.6 bits, see alignment E=2e-10 PF00004: AAA" amino acids 205 to 323 (119 residues), 23.2 bits, see alignment E=1.6e-08 PF08299: Bac_DnaA_C" amino acids 415 to 480 (66 residues), 93.1 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 100% identical to DNAA_MYCTA: Chromosomal replication initiator protein DnaA (dnaA) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 99% identity to mbo:Mb0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>Rv0001 Chromosomal replication initiator protein DnaA (Mycobacterium tuberculosis H37Rv)
LTDDPGSGFTTVWNAVVSELNGDPKVDDGPSSDANLSAPLTPQQRAWLNLVQPLTIVEGF
ALLSVPSSFVQNEIERHLRAPITDALSRRLGHQIQLGVRIAPPATDEADDTTVPPSENPA
TTSPDTTTDNDEIDDSAAARGDNQHSWPSYFTERPHNTDSATAGVTSLNRRYTFDTFVIG
ASNRFAHAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVKYVSTE
EFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQI
VISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPDDVLEL
IASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVLRDLIADANTMQISAATIMAAT
AEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYAQRKI
LSEMAERREVFDHVKELTTRIRQRSKR