Protein Info for RS_RS24900 in Ralstonia solanacearum GMI1000

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF00563: EAL" amino acids 159 to 394 (236 residues), 190.5 bits, see alignment E=1.6e-60

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS02180)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XPL5 at UniProt or InterPro

Protein Sequence (421 amino acids)

>RS_RS24900 EAL domain-containing protein (Ralstonia solanacearum GMI1000)
MHTGNPQAPFVNIEHALIACENELQRCYVSRLLQRLGITAVSSVSTTVDLLAQVRERPFK
LFVISSWLPGTPILQLIDALADSGRGGYIIVSGLSDRRIQHAISEYARLRNGENVRLIFA
GEPLRLFDFTDMLCLAGAPSARHREGALPDAVAQRFSAQAILRAYRSGEISVFFQPQYCL
ATGVLLGAEGLVRWRHPDLGVLGPDHFLPTLEDLGLGQDLIDQLIRAAADISQSLQKTPT
PLKLSINIPSAHIVSAAWAETIVQQINAAAGTCAGITIEVTEDSAPGISDSNIAGAVAHW
RLNGIDCAIDDFGTGASTLRRLCLAPFNILKIDRRMVWRSRLATHVCRMLEAMVDMAHGL
GMRVIAEGIETESDLARMRGMKCDAGQGYYFSRPLPDADFRALAMASSNNAFRQRAPVLS
H