Protein Info for RS_RS24660 in Ralstonia solanacearum GMI1000

Annotation: cytochrome c oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details PF03626: COX4_pro" amino acids 24 to 94 (71 residues), 49.9 bits, see alignment E=1.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS02124)

Predicted SEED Role

"Putative subunit of Alternative cytochrome c oxidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XPS0 at UniProt or InterPro

Protein Sequence (112 amino acids)

>RS_RS24660 cytochrome c oxidase subunit IV (Ralstonia solanacearum GMI1000)
MEHTDPSHAPGAHGQQHPIGIYLKIWGLLFVLSTLSYLVDYFRVQGLMRWTLIVALMIAK
AGLIVSVFMHMMWERLALVYAILIPPLCLLVLMVLMAAEAHHTFGMRALFFH