Protein Info for RS_RS23795 in Ralstonia solanacearum GMI1000

Annotation: sulfonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF13379: NMT1_2" amino acids 43 to 260 (218 residues), 52.5 bits, see alignment E=1.6e-17 TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 44 to 326 (283 residues), 239.6 bits, see alignment E=2e-75 PF04069: OpuAC" amino acids 67 to 250 (184 residues), 34 bits, see alignment E=6e-12 PF00497: SBP_bac_3" amino acids 69 to 253 (185 residues), 33.7 bits, see alignment E=6.9e-12 PF12974: Phosphonate-bd" amino acids 69 to 216 (148 residues), 44.8 bits, see alignment E=2.9e-15 PF09084: NMT1" amino acids 84 to 262 (179 residues), 53.9 bits, see alignment E=5.9e-18

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to rso:RSp1383)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XQA3 at UniProt or InterPro

Protein Sequence (334 amino acids)

>RS_RS23795 sulfonate ABC transporter substrate-binding protein (Ralstonia solanacearum GMI1000)
MPAPSPHATATPPTRRRRWLAALLGAGLALCGGMAAAADPAGTVRIGFQKAGLLAVLKAQ
GALDTPLAELGYRIEWKEFPAGPQLLEALNAGSIDFGYTGAPPAVFAQAAGARFVYVGAE
PGASANEALFVRDGSPARGVADLKGKRIALQKGSSSNYLLVQLLKRAGLTVQDIQPIYLP
PAEARAAFESGAVDAWVVWDPYYALAQTALKVRTLADYTGLPSPFNFYEATPGFVQAHPR
AVNAILAQLRTTGLWVNRHPRETAALLSPKLGIAPPVVETWLRRVPYGVTPITPEVIAAQ
QQVADLFHQQKLIPRPVSVQGAVWRASFPVAAAD