Protein Info for RS_RS23740 in Ralstonia solanacearum GMI1000

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 58 to 83 (26 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 11 to 273 (263 residues), 153.4 bits, see alignment E=1.7e-48 PF12730: ABC2_membrane_4" amino acids 24 to 186 (163 residues), 41.5 bits, see alignment E=2.9e-14 PF12698: ABC2_membrane_3" amino acids 61 to 189 (129 residues), 33.1 bits, see alignment E=6.9e-12 PF13346: ABC2_membrane_5" amino acids 61 to 188 (128 residues), 30.5 bits, see alignment E=5.3e-11

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to rso:RSp1372)

Predicted SEED Role

"Nitrous oxide reductase maturation transmembrane protein NosY" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XQB4 at UniProt or InterPro

Protein Sequence (274 amino acids)

>RS_RS23740 ABC transporter permease (Ralstonia solanacearum GMI1000)
MTGVECRQVAILAAKELRERLRNRWVLTVAAVFAVFSLVICYFGGAEQGALGPHSIEFVI
TSLVSLVIYLIPLIALLLGFDAIVGERERGTLDLLLALPITRLELLLGKFLGLAAALTLS
TLAGFALMVALLWRQFGRVGLVQSAGFVLSSILLGLVFLSLALCVSVLSRERTRASGLAI
ALWFGFVLVFDLLLLGLLVASGGAVGGPALAYLLLLNPTDIFRILNVFSLDQLRGFQGLV
SIVPPALGNPWAMGGAMLAWIAAPLALAAWRFRS