Protein Info for RS_RS23565 in Ralstonia solanacearum GMI1000

Annotation: IS5-like element ISRso1 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF13340: DUF4096" amino acids 24 to 97 (74 residues), 84 bits, see alignment E=1e-27 PF01609: DDE_Tnp_1" amino acids 112 to 264 (153 residues), 110.2 bits, see alignment E=1.8e-35 PF13586: DDE_Tnp_1_2" amino acids 215 to 264 (50 residues), 36.5 bits, see alignment 8.6e-13

Best Hits

KEGG orthology group: K07492, putative transposase (inferred from 100% identity to rso:RSc3351)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>RS_RS23565 IS5-like element ISRso1 family transposase (Ralstonia solanacearum GMI1000)
MWKKEHREREAKLGRKTKRYPSDLTDIEWVAVQPLLPRAAVRGRRRECDLREVVNALRYL
VRAGCGWRMLPHDFPPWQTVYWWFRRLMRRLLFRTLHDVVLMLDRELAGRQPCPSAGVID
SQTVKAPSADKRGYDAAKKIVGRKRHIAVDTDGRLLMVNLTPADIADSTGALAVLEAVKK
RWPGIKHLFADGAYDRTALMDKASTLDFVVEVVRRHEQQTGFAVLPRRWVVERTFGWMVR
WRRLVRDYEQRADVSEAMIHIAMSGLLLRRIAHP