Protein Info for RS_RS23160 in Ralstonia solanacearum GMI1000

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF12833: HTH_18" amino acids 33 to 111 (79 residues), 71.1 bits, see alignment E=1.6e-23 PF06445: GyrI-like" amino acids 127 to 277 (151 residues), 112.6 bits, see alignment E=4.2e-36 PF14526: Cass2" amino acids 129 to 276 (148 residues), 49.8 bits, see alignment E=9.5e-17

Best Hits

KEGG orthology group: K13652, AraC family transcriptional regulator (inferred from 100% identity to rso:RS03191)

Predicted SEED Role

"PROBABLE TRANSCRIPTION REGULATOR PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XQH8 at UniProt or InterPro

Protein Sequence (279 amino acids)

>RS_RS23160 AraC family transcriptional regulator (Ralstonia solanacearum GMI1000)
MKPSTERSYAQRIARVVEAIVADPGAPHTVESLAAVAHLSPYHFHRIYRALTGESIAATV
QRVRLARAAHRLTGASEPVSAVALEVGYDSPQAFARAFRGFAGVSPSAFHARQQSLSSAR
SGTSVPHVELIELPPIEVVCLRHDGPVATIGQTFRTLMRMLHTGQALPGTPERIGICCGD
PEVRDTFRYYAAAAVPPARGLPSGSLEPARIEGGLYARHRLVGPYALIAPTFEALFGGWL
PHSSYEPDDRPALERYRSPPSPPQQRDCVTDLLIPIRKD