Protein Info for RS_RS22855 in Ralstonia solanacearum GMI1000

Annotation: MurR/RpiR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 119 to 142 (24 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details PF01418: HTH_6" amino acids 5 to 79 (75 residues), 57.1 bits, see alignment E=2.2e-19 PF01380: SIS" amino acids 127 to 254 (128 residues), 64.4 bits, see alignment E=1.4e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS03130)

Predicted SEED Role

"Transcriptional regulator, RpiR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XQN6 at UniProt or InterPro

Protein Sequence (289 amino acids)

>RS_RS22855 MurR/RpiR family transcriptional regulator (Ralstonia solanacearum GMI1000)
MREPMDIVTRISQRATDLRPAEQKVAQTVLGDIAGAAEGSIQTLAERAGVSEASVTRFAK
AMGCRDVRELKLKLAQAAAVGQRFLDGGADRPPSSADGILADITHVLEANRALVRPEAFR
AAAAALVGARMIAVFGMGGGSTTMADEMRYRLARLGRPVSTYHDAMLQRMVAATLGPEDV
VVVFSVTGQVPEIIDGVNIAREYGAKVVAVTAIGSPVAALADILLPIQAMETDFIFKPSS
SRYAMMMMIDLLATDVALQQADRSKELLRRIKHVLDAHRGGGNRQPLGD