Protein Info for RS_RS22785 in Ralstonia solanacearum GMI1000

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details PF03741: TerC" amino acids 15 to 203 (189 residues), 157.6 bits, see alignment E=2.9e-50 PF03471: CorC_HlyC" amino acids 438 to 516 (79 residues), 59.6 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS05062)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XQP9 at UniProt or InterPro

Protein Sequence (526 amino acids)

>RS_RS22785 TerC family protein (Ralstonia solanacearum GMI1000)
MSWLADPSIWIGLVTLVVLEIVLGIDNLVFIAILVNKLPPALRDRARMIGLGLALVMRMV
LLSMMSWLITLTKPLLTLGPVALSGRSIILLLGGFFLLFKATSELHERLDGQPQDDSHGA
GQGKFWNVIAQVVVLDAVFSLDSVITAVGMVNDLPVMMAAVAVAMGAMLFASRPLTDFVN
AHRTVVVLCLSFLLMIGFSLVAEGLGFHIPKGYLYAAIGFSILIEFFNQVAQRNSDRYER
RRPLRERTADTVLSLLGERRADHGTGEAEAAASRAPGLPTPETVFRPEERSMVSGVLGLA
ERSVRSIMTPRHDISWVDLEGDIAHTRQLLLAVPHNQFPVCRGGLDDLVGVARAKDLMGD
LDTRGAIDVERSVKPALKVSDGIGILRLMDQLKRSRGRMMVVTDPLNVVQGVVTPIDVLE
AIAGEFPDEDERPGVVALREGCWEVAGEADLRQLEDILHVDWLLDEGGGATSLGGYLFRQ
WDRLPEVSDALVRHDLRFVILEVGSRRIMRVRIERMEDVTAPEAEA