Protein Info for RS_RS21895 in Ralstonia solanacearum GMI1000

Annotation: cytochrome c

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13442: Cytochrome_CBB3
  • amino acids 78 to 162 (85 residues), 52.5 bits, E=5e-18
• PF00034: Cytochrom_C
  • amino acids 78 to 166 (89 residues), 59 bits, E=9.8e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS02321)

Predicted SEED Role

"Copper-containing nitrite reductase (EC 1.7.2.1)" in subsystem Denitrification (EC 1.7.2.1)

MetaCyc Pathways

• nitrate reduction I (denitrification) (4/5 steps found)
• nitrate reduction VII (denitrification) (4/5 steps found)
• ammonia oxidation II (anaerobic) (1/3 steps found)
• nitrite-dependent anaerobic methane oxidation (1/3 steps found)
• nitrifier denitrification (3/6 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.1

Use Curated BLAST to search for 1.7.2.1

Sequence Analysis Tools

See Q8XR70 at UniProt or InterPro

Protein Sequence (203 amino acids)

>RS_RS21895 cytochrome c (Ralstonia solanacearum GMI1000)
MPNDKSAPPPTRQEQREHAEPGESQTPIPLGIKLLVAVLIVWGIYYIANAPINVPSSLGD
GRTVADLEKGKAGGGSGAADGAALFASRCAACHQAAGQGLPGVFPPLAGSEWVQGRPETV
AAIVLHGIAGPLTVKGAKFNGAMPTFSDQLSDAEIAAVLSYVRSQWGNAAAPILAQAVTQ
VRDATKGRTAPYNGDDELGKLKW