Protein Info for RS_RS21870 in Ralstonia solanacearum GMI1000

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 142 to 167 (26 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 8 to 208 (201 residues), 68.9 bits, see alignment E=4.2e-23 PF07690: MFS_1" amino acids 41 to 369 (329 residues), 84 bits, see alignment E=1e-27

Best Hits

KEGG orthology group: K08173, MFS transporter, MHS family, metabolite:H+ symporter (inferred from 100% identity to rso:RS02317)

Predicted SEED Role

"PROBABLE TRANSPORTER TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XR74 at UniProt or InterPro

Protein Sequence (409 amino acids)

>RS_RS21870 MFS transporter (Ralstonia solanacearum GMI1000)
MRASLASLLGSTIEWYDFFLYGAASALVFNQVFFPKLGALSGAIAAFGTYGLGFVVRPLG
ALAFGHFGDRLGRKTVLLASLLAMGLPTVLIGLLPSYDAIGYLAPLLLIVLRLVQGFAVG
GEWGAVILAVEHASPRFKGLLGGLSQTGVAAGLTLSSLAMAAVSAIGHEAMLSWAWRIPF
VASGLLVALGWLLRRKVDETPEFASAKQQGRCLKYPVSNVFKDHAGALLSVAGARVAEIS
FFYIVTAFTLWYATKQLGLPGAWCLNGVTLGAAAATFLMPLCGMLGDRWGARRIYIAGIV
TALLWILPFFMLVNTRAMVWVVLAEAVSVVLSFSMAAQQASLFVQQFPVIARYTGASLAV
NIAGALGGLAPIVATALLGNVPDGVTYIAGYVAALAVISIASALRLRKV