Protein Info for RS_RS21585 in Ralstonia solanacearum GMI1000

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 25 to 51 (27 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 27 to 119 (93 residues), 75.1 bits, see alignment E=2.6e-25 PF00528: BPD_transp_1" amino acids 43 to 225 (183 residues), 63.8 bits, see alignment E=9e-22

Best Hits

Swiss-Prot: 34% identical to TCYB_BACSU: L-cystine transport system permease protein TcyB (tcyB) from Bacillus subtilis (strain 168)

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 100% identity to rso:RS05400)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XRC5 at UniProt or InterPro

Protein Sequence (248 amino acids)

>RS_RS21585 amino acid ABC transporter permease (Ralstonia solanacearum GMI1000)
MMDLVDIVSDNWLLLLVGQYPNGPLGGIACTLILSVLGIVLAFPLSVLLALARLSPWSAL
RSVVTALVYGVRGVPLLMLILWVYFLVPLFIGRDVSGFTTMLCTLVIYEGVYLSEVVRAG
IEALPKGQMEAARALGHSYLGAMRVVILPQALYNMLPSMLAQFVSTIKETTLGYVINVPE
LTFAANQINNALLSKPFQIFFLLAVIYFAVCWSLTRAARALEHRIAAKRAGKRRVPAPEV
PEPLPVEP