Protein Info for RS_RS21515 in Ralstonia solanacearum GMI1000

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00072: Response_reg" amino acids 10 to 118 (109 residues), 92.3 bits, see alignment E=2.3e-30 PF00486: Trans_reg_C" amino acids 160 to 234 (75 residues), 63.4 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 42% identical to MTRA_MYCS2: DNA-binding response regulator MtrA (mtrA) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: None (inferred from 100% identity to rso:RS01694)

Predicted SEED Role

"Transcriptional regulatory protein RstA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XRD7 at UniProt or InterPro

Protein Sequence (259 amino acids)

>RS_RS21515 DNA-binding response regulator (Ralstonia solanacearum GMI1000)
MAEAPLKTRVLLIEDDDRLAQLVSEYLGNYEFTVEVVRRGDIAVAAVREHRPALVILDLM
LPHMDGMEVCRRIRAFSRVPVLILTARVDTYDQVAGLEIGADDYVLKPVEPRLLVARARA
LLRRVASAMPAAEPATPRDDTLVFGELAISPPNRTVTWRGQPVELKTAEFNLLLILARAA
GTVLSRDDILKQLRGIEFDGLDRTVDSGISRLRRRFGDASPEPHKIKTGGDPGYLGDGSA
SSTRLRSGTDAAGAASAAY