Protein Info for RS_RS21245 in Ralstonia solanacearum GMI1000

Annotation: EscR/YscR/HrcR family type III secretion system export apparatus protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 9 to 212 (204 residues), 298.7 bits, see alignment E=1.1e-93 PF00813: FliP" amino acids 14 to 212 (199 residues), 217 bits, see alignment E=1.1e-68

Best Hits

Swiss-Prot: 100% identical to HRCR_RALSO: Hypersensitivity response secretion protein HrcR (hrcR) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 99% identity to rsl:RPSI07_mp0806)

Predicted SEED Role

"Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q52488 at UniProt or InterPro

Protein Sequence (217 amino acids)

>RS_RS21245 EscR/YscR/HrcR family type III secretion system export apparatus protein (Ralstonia solanacearum GMI1000)
MQNVEFASLIVMAVAIALLPFAAMVVTSYTKIVVVLGLLRNALGVQQVPPNMVLNGIAMI
VSCFVMAPVGMEAMQRAHVQINAQGGTNITQVMPLLDAARDPFREFLNKHTNAREKAFFM
RSAQQLWPPAKAAQLKDDDLIVLAPAFTLTELTSAFRIGFLLYLAFIVIDLVIANLLMAL
GLSQVTPSNVAIPFKLLLFVVMDGWSVLIHGLVNTYR