Protein Info for RS_RS21005 in Ralstonia solanacearum GMI1000

Annotation: GGDEF-domain containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 159 to 181 (23 residues), see Phobius details PF17152: CHASE8" amino acids 44 to 148 (105 residues), 58.8 bits, see alignment E=8.3e-20 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 196 to 368 (173 residues), 119.8 bits, see alignment E=4.9e-39 PF00990: GGDEF" amino acids 199 to 365 (167 residues), 146.5 bits, see alignment E=9.3e-47 PF00563: EAL" amino acids 386 to 629 (244 residues), 244.5 bits, see alignment E=1.5e-76

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS01894)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XRL8 at UniProt or InterPro

Protein Sequence (663 amino acids)

>RS_RS21005 GGDEF-domain containing protein (Ralstonia solanacearum GMI1000)
MMMAFKPWRSQLSRAVLRTNMAAAGAALAIAGVLLIAFQFVALRAALVRDVHVQARIIGA
NSVAALLFNDRRAAEETLGALAGSPSLRAAGVFTAQRLPLGLYQRGEAAPVRSPDAALMR
DHDESTATRLVVVEPIFSERRVIGYVVIRSSLDDLYLQLLGYAALTVTVGIGAMGLAYLV
IARTRRAVLQAEAHLDYLAHVDSVTDLPNRHAFNQRLREALESAGQAGAIGLLLLDLDNF
KVVNDTLGHNNGDRLLRQVARRLNDVIEQSNVRAVLCRIGGDEFAVIAELSRRASITNPE
AAELSSALANRILAALAAPFALDLHQIYVTASVGVSLYPHDAGDVQSLTRNADAAMYSAK
NRGKNAAACFTAEMDQQARRRLRVESDLRRALEHEELLLVYQPQIRLDALAQAGAHVCSA
HVHGVEALVRWRHPEIGLIGPGEFIAVAEETGLIVPLGLWVLRTACQQAAQWLHAGRATL
RVAVNLSPRQARDPALAENVLGILRETGLPPHLLELEITESVLMEDIDANIRLLEALHAA
GVNLSIDDFGTGYSSLAYLQRFPIHKLKIDRSFVQRMPGDGEAIASAVIAMAHSLRMQVV
AEGVEHAGQLAWLRAAGCDLGQGYLFSRPLHAEQLMSWLRRQDSAAPPFDAEIIPSTERT
DAS