Protein Info for RS_RS20060 in Ralstonia solanacearum GMI1000

Annotation: cobyrinate a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01656: CbiA
  • amino acids 21 to 194 (174 residues), 50.1 bits, E=4.1e-17
• TIGR00379: cobyrinic acid a,c-diamide synthase
  • amino acids 21 to 438 (418 residues), 264 bits, E=1.3e-82
• PF07685: GATase_3
  • amino acids 246 to 430 (185 residues), 107.5 bits, E=1.1e-34

Best Hits

Swiss-Prot: 59% identical to COBB_PSEAE: Hydrogenobyrinate a,c-diamide synthase (cobB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 100% identity to rso:RSp0615)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (29/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (11/13 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

See Q8XS66 at UniProt or InterPro

Protein Sequence (440 amino acids)

>RS_RS20060 cobyrinate a,c-diamide synthase (Ralstonia solanacearum GMI1000)
MTMATSPDAARQCPALFLSAPASHQGKTTLTAGLARHHRNQGRTVRVFKTGPDYLDPYIL
ERASGQPVHSLDLWMTGEADCRQRLYAAAAEADLILIEGAMGLFDGTPSSADLAEAFGVP
VLALIDASAMAQTFAAIAHGLASFRPALPFHGVLANRVASPRHAELLTAALPAGLRCLGT
LARDDAMTLPERHLGLVMAQEIDDLEPRLEHAAARIATTGLAELPPPVAFAPARAAPMPP
LLAGTRIAIARDAAFSFLYPANLELLAGLGAELRFFSPLADAALPPADAVYLPGGYPELH
LDALSANRALHAALHAHAGAGKPLYAECGGMLYLADTLTDAAGRRGTMAGLLPGAATLHT
RLAGLGLQAVDLGDGELRGHTFHYSSLATPLAPATHARRAHGAGNAAPGEAVYRHGSIVA
SYLHAYFPSNPTAAARLFRP