Protein Info for RS_RS20045 in Ralstonia solanacearum GMI1000

Annotation: DUF2784 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details PF10861: DUF2784" amino acids 4 to 119 (116 residues), 93.4 bits, see alignment E=4.7e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS03755)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XS69 at UniProt or InterPro

Protein Sequence (122 amino acids)

>RS_RS20045 DUF2784 domain-containing protein (Ralstonia solanacearum GMI1000)
MIRLADTVLVLHALVALFIVGGLIAILAGAALRQGWVRNRTFRLTHLAAIGVVAMLALFD
LPCPLTVLEDRLRTGAAGPQGFVQRWVSAWLYYDLPAWVFATAYVAFLLVVVVTWWRIPP
RA