Protein Info for RS_RS19705 in Ralstonia solanacearum GMI1000

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 59 to 381 (323 residues), 149.5 bits, see alignment E=5.7e-48 PF16576: HlyD_D23" amino acids 68 to 306 (239 residues), 189.9 bits, see alignment E=5.8e-60 PF13533: Biotin_lipoyl_2" amino acids 88 to 127 (40 residues), 35 bits, see alignment 1.4e-12 PF13437: HlyD_3" amino acids 204 to 302 (99 residues), 67.7 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: None (inferred from 93% identity to rsl:RPSI07_mp0460)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XSE7 at UniProt or InterPro

Protein Sequence (390 amino acids)

>RS_RS19705 efflux RND transporter periplasmic adaptor subunit (Ralstonia solanacearum GMI1000)
MTHRSSSLSSSWRLAAVAAAAVLLLGACGKDGTDAARAAQQAADPNVVVAPPALTARLKV
APAGQQAVSERLRVPGQIDFDEQRLARIGASVTGRVTELLVVPGQQVKAGDILAQLHSTE
LGTAQLAYQKAVAQRDLQARALERAKLLLAADVIGSAELQKRQSELAMAQAEVRAAVDQL
RVMGVSPATLAKMRTGGMSSISPVVASLGGTVVERKVTRGQVVQPADALFTVADLSRVWV
VGQVPESAAPLVRAGQAVEIETGAPGGRIVGKLIWVSDIVDPQTRTVTVRTEVDNPERAL
KPSMLATLLIESRPEQKLVVPTAAVVREDNRDYVFVQVSQTDYRLVPVKLGDESNGVRPV
ASGLQAGQPIVVEGGFHLNNERKRAEMEGA