Protein Info for RS_RS19475 in Ralstonia solanacearum GMI1000

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF13404: HTH_AsnC-type" amino acids 6 to 47 (42 residues), 43.2 bits, see alignment E=5.4e-15 PF13412: HTH_24" amino acids 6 to 52 (47 residues), 45.5 bits, see alignment E=8.7e-16 PF08279: HTH_11" amino acids 13 to 53 (41 residues), 26.1 bits, see alignment E=1.3e-09 PF01037: AsnC_trans_reg" amino acids 74 to 142 (69 residues), 57.4 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to rsl:RPSI07_mp0416)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XSJ2 at UniProt or InterPro

Protein Sequence (145 amino acids)

>RS_RS19475 Lrp/AsnC family transcriptional regulator (Ralstonia solanacearum GMI1000)
MSISSLDDTDRELIGLLRDNARLSIVTLAKKLRVARATVQNRIAKLERDGVIVGYTVRLR
PNVDTQRIRAITCIAVEGNRATEIRRRLTGHPNVVALHTTNGRWDLVAELRTDTLEAFDT
VLNELRLIDGIANTETSILLSTYKL