Protein Info for RS_RS18835 in Ralstonia solanacearum GMI1000

Annotation: flagellar assembly peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 11 to 360 (350 residues), 333.6 bits, see alignment E=7.8e-104 PF10135: Rod-binding" amino acids 49 to 95 (47 residues), 55.4 bits, see alignment 7.2e-19 PF01832: Glucosaminidase" amino acids 221 to 360 (140 residues), 127.6 bits, see alignment E=4.6e-41

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 100% identity to rso:RSp0350)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XSW7 at UniProt or InterPro

Protein Sequence (361 amino acids)

>RS_RS18835 flagellar assembly peptidoglycan hydrolase FlgJ (Ralstonia solanacearum GMI1000)
MNRTDISNRLALDAQGFESLKQTARTDPTAAAKTVAKQFDAIFVNMMLKQMREASPQNGL
LDSSSSKMYTSMLDQQLSQTLASRGVGVADQLLKQMLRQAAKTNPDASGSVNTALSRTTA
TNTALPGAAGSTTTDAAKAIARASLNGLAATAAAGTEDDGSGISTVPRPGLEERVQRALA
ALRKQAEAQSSGGTLPEADLSSVASQPAGDRMSSFYNKLIDHATQASQETGIPASFMIGH
AALESGWGRREIRAKDGTSSHNLFGIKAGGSWTGPTTEVMTTEYVGGVAHKVKEKFRAYG
SYAEAFKDYANLLSSNPRYSNVVAAGAGKDAASFARGLQRAGYATDPNYANKIMAVLRQI
A