Protein Info for RS_RS18480 in Ralstonia solanacearum GMI1000

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00704: Glyco_hydro_18" amino acids 98 to 364 (267 residues), 35.6 bits, see alignment E=9.3e-13 PF02839: CBM_5_12" amino acids 361 to 398 (38 residues), 36.7 bits, see alignment 3.4e-13

Best Hits

KEGG orthology group: K01183, chitinase [EC: 3.2.1.14] (inferred from 100% identity to rso:RS03689)

Predicted SEED Role

"Chitinase (EC 3.2.1.14)" in subsystem Chitin and N-acetylglucosamine utilization (EC 3.2.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XT40 at UniProt or InterPro

Protein Sequence (401 amino acids)

>RS_RS18480 membrane protein (Ralstonia solanacearum GMI1000)
MKPRVSPRFATRAVAALCLSAAAGASHAAGVYAPYIDMTLDPTPLIDQIGVRQGIQQFHL
AFVIAGDGCTPSWGGIQAIGNGASGDLLTTIAASITRYRARGGEVSVSFGGAAGTPLMKA
CTTVPALKAAYQTVIDTYQLTHVDFDIEGSVQKDTEAVARNFQAIAQLQSDFAAKGRALH
VTLTLPVLPSGLVQDGINTLNAAIANKVALDTVNVMTMDYGPADIDMGAAAISAAQGLYA
QLDTAYKVVGQVKTDAQLWRLVGVTPMIGMNDVQSETFTLPNALTVLGAAYGNGYGMVSN
WSVGRDQACPDNGAVVSPTCSGIVQRPYAFASIFRQLHGHWGTGVLRDPSYGNATGGSAP
AWSATAVYRIGQCVTYQDAKYCARWWTQGNVPNAGGVWAKS