Protein Info for RS_RS18455 in Ralstonia solanacearum GMI1000

Annotation: TIGR02678 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR02678: TIGR02678 family protein" amino acids 23 to 401 (379 residues), 509.3 bits, see alignment E=3.4e-157 PF09661: DUF2398" amino acids 24 to 396 (373 residues), 371.1 bits, see alignment E=3.3e-115

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS03693)

Predicted SEED Role

"FIG087842: Hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XT44 at UniProt or InterPro

Protein Sequence (416 amino acids)

>RS_RS18455 TIGR02678 family protein (Ralstonia solanacearum GMI1000)
MSNDSHDIGRQQARHRDDERTQALRALLMTPLMTPAHESFAAVRRHADELRAWFARETGW
TLHIERDCARLYKRPADLQDASRGLPGYERRRYVLLCLACAVLERADPQITLRVLGDRLL
ALAADPALASRNFHFTLGAAHERRELVAVCRSLVELGVLQRIAGDEESFVRSTGDAADSG
DALYDVRRRVLAGLLAAVRGPSTWPAEQTPVSLDERLASLVAEHMPDSDDGLRTALRHDL
ARRLLDNPVVYLNTLDAELRAYFVNQRGAMATRLCDATGLVAEQRAEGLALVDEDGELTD
VAMPAEGTEAHATLLVAEFLACRSRADAQTPTTLDEITAFLADARTRYGSYWRKSAREPG
AERELTTVALERLLKLQLVARMADRIQPLPALARFALGETDIRAPIRSATQSNLFE