Protein Info for RS_RS18280 in Ralstonia solanacearum GMI1000

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 369 (346 residues), 140 bits, see alignment E=9.2e-45 PF00083: Sugar_tr" amino acids 50 to 189 (140 residues), 58.6 bits, see alignment E=5.8e-20 amino acids 224 to 414 (191 residues), 33.1 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS05189)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XT81 at UniProt or InterPro

Protein Sequence (416 amino acids)

>RS_RS18280 MFS transporter (Ralstonia solanacearum GMI1000)
MFGWFKEISAGEKRTFWACFGGWALDALDVQMFSLVIPTIIAAWHIGKTEAGLVSGITLV
ASALGGWIAGAMTDRLGRVRTLQITVAWFSLATFASAFAQNFEQFLALKAVQGFGFGGEW
AAGAVLMAESIRASHRGKAMGTVQSAWAVGWGAAVLLYALTYSLVEPDLAWRVMFAAGVL
PALLIIYIRRGVQEPAPAGAKAEAGPDGMPVSRFPLLDIFRPRVLRMTLIGALLGVGAHG
GYYALMTWLPTYLKTERHLSVLGTGGYLAVIIFAFWCGCVASAWLLDVIGRRGNILLFSC
CCVVTVLVYLLVPLSDGAMLVLGFPLGFFAAGIPASMGALFNELYPHGVRGTGVGFCYNF
GRVVSAAFPVLVGKMSASMSLGTAIGIDAAIAYSIVAVAVLMLPETRGRDLAAVTA