Protein Info for RS_RS18125 in Ralstonia solanacearum GMI1000

Annotation: acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 42% identical to Y535_CHLTR: Uncharacterized acyl-CoA thioester hydrolase CT_535 (CT_535) from Chlamydia trachomatis (strain D/UW-3/Cx)

KEGG orthology group: None (inferred from 100% identity to rso:RS05225)

Predicted SEED Role

"Acyl-CoA hydrolase (EC 3.1.2.20)" (EC 3.1.2.20)

MetaCyc Pathways

palmitoleate biosynthesis IV (fungi and animals) (2/2 steps found)
acyl-CoA hydrolysis (1/1 steps found)
firefly bioluminescence (3/14 steps found)
jasmonic acid biosynthesis (5/19 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.20

Use Curated BLAST to search for 3.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XTB0 at UniProt or InterPro

Protein Sequence (164 amino acids)

>RS_RS18125 acyl-CoA thioesterase (Ralstonia solanacearum GMI1000)
MNTQSHQLSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRYAGRYVVTLSVDQVVF
RQPIHVGELVTFLASVNYTGRTSMEIGIKVVTENIRNKVVRHTNSCYFTMVAVDDDGKPA
DVPPLTPTDAQEKERFEAAQQRRALRQEMEQRHKAIKAAYSAAN