Protein Info for RS_RS17695 in Ralstonia solanacearum GMI1000

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 41 to 74 (34 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 332 to 362 (31 residues), see Phobius details amino acids 382 to 413 (32 residues), see Phobius details PF00916: Sulfate_transp" amino acids 11 to 376 (366 residues), 172.7 bits, see alignment E=5.4e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS03009)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XTJ5 at UniProt or InterPro

Protein Sequence (520 amino acids)

>RS_RS17695 SulP family inorganic anion transporter (Ralstonia solanacearum GMI1000)
MQTPTQPAFFPRDMLAGTIVFFVALPLCLGIASASGVDPLAGLMSGMIGGLVVALLSGSQ
LSVSGPAAGLVVIVVDGIAKLGGFSAFLMAVLLSGVLQFVFGMLRAGRFAAYVPSSVIKG
MLAAIGLLLIIKQVPLAFGFARADAAAAAGAIVTPFGSVSAAAMAVTALSAAVLIGWETR
ALRRFLLVRALPAPLMVVALGIGVTLLLDAVAPGVAPPVEHRVGLPSLASFGALFDALQS
PSLDALTNPDVWQLALALAIVASLETLLSLEAVEQIDPKKRPAPADRELKAQGIGNMMAG
VFGALPITSVIVRSSANVQAGAQSRWSAVVHGALLLASVFTLTSIVNLIPLACLATILIF
TGFKLAKPSLFVSVARQGMERFAPFIVTIVGVLLTDLLIGILMGIALSIALAIRANLRRS
IVMARHHDHFLLSFRKDVSFMGKVPLKRYLAQVPDYTTLIIDASRADYIDPDVRELVERF
IEDAPSRGILIERHHFDAAAPQPTRASKLLKLRFSRCPAR