Protein Info for RS_RS17525 in Ralstonia solanacearum GMI1000

Annotation: GlxA family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 35 to 190 (156 residues), 51.9 bits, see alignment E=1.3e-17 PF12833: HTH_18" amino acids 254 to 331 (78 residues), 77.3 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RS02043)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XTN8 at UniProt or InterPro

Protein Sequence (334 amino acids)

>RS_RS17525 GlxA family transcriptional regulator (Ralstonia solanacearum GMI1000)
MTSVAAASVEPAVCASRSMSSLAHFGFLTLPNFSMIAFSSAVEVLRMANYVGRAEQYTWS
IYSPDGAPVRASNGIAVHPTRAVDVAQLPDVMIVCGGTGIRDVVDHRLCGLLTSIAERGI
PLGGICTGAYALMSSQLLDGYRCSVHWENRSALQEAFPHVRFVDELFAIDGDRLTCTGGT
APIDMMLNLVGLRFGQRMSAQVAEQFILERIRGTADIQPIPVDVRVGFLRTELIEVLRLM
EANIEEPLSLEELTRLVNLSQRHLQRMFRFYLNVSPTHYYLTLRLKRARDLLRTTNASIA
RVTTICGFHSQCHFSKAYRTQFGYAPSHERRIPD